PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo21G0031800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 283aa    MW: 29924.5 Da    PI: 7.7798
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo21G0031800genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd  l+++v+ +G+g +W + +++ g++R++k+c++rw++yl
  Spipo21G0031800 14 RGPWSPEEDAALKNYVENHGTGgNWIALPQRAGLKRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding41.82.5e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd  +  ++k  G++ W+ Ia++++ gRt++++k++w++
  Spipo21G0031800  69 GGFSAEEDNVICSLFKTIGSR-WSVIASHLP-GRTDNDVKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.495966IPR017930Myb domain
SuperFamilySSF466891.16E-2711109IPR009057Homeodomain-like
SMARTSM007171.0E-111364IPR001005SANT/Myb domain
PfamPF002491.1E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-231569IPR009057Homeodomain-like
CDDcd001674.08E-91662No hitNo description
SMARTSM007173.1E-1267115IPR001005SANT/Myb domain
PROSITE profilePS5129415.33767117IPR017930Myb domain
PfamPF002499.0E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-2370117IPR009057Homeodomain-like
CDDcd001671.17E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MGRAPCCDKA SVKRGPWSPE EDAALKNYVE NHGTGGNWIA LPQRAGLKRC GKSCRLRWLN  60
YLRPGIKHGG FSAEEDNVIC SLFKTIGSRW SVIASHLPGR TDNDVKNYWN TKLKKKMLAG  120
QADLYSTTNR NDSLIHQAPS PPPVPRPMPL VKSENYGFGS FSMSSKSCGF GSFYMSNENS  180
SSSALTSVDA GPWLDSSNLA PDSASFTMMG HADLSNCGGS APAYAVSPSQ DMSAGSSSLS  240
TETSNSHVSW PGNGGGGIDA FLMDLGLAPV DLLAAGGYSL LD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008798607.11e-88PREDICTED: transcription factor RAX1-like
RefseqXP_008794081.11e-88PREDICTED: transcription factor RAX2-like
TrEMBLB9HE033e-80B9HE03_POPTR; Uncharacterized protein
STRINGPOPTR_0006s25060.18e-80(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.15e-75myb domain protein 84